| Read Date | 2005-07-01 09:02:00 |
|---|---|
| Read Number | X0000052581424200507010902 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C1436 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Magnesium formate dihydrate | 7.1 | 0.1 M | [Mg+2].[O-]C=O.[O-]C=O |
| PEG 3350 | 7.1 | 15.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | JR18 |
|---|---|
| Spine Status | aggregation screening |
| Length | 136 aa |
| Mass | 16.01 kD |
| ext | 23950 |
| pI | 8.65 |
| Name | Hypothetical UPF0066 protein PH1056 |
| Database References | NCBI UniProt |
| PFAM | PF01980 |
| PDB Structures | 2NV4 (Best Match) |
| Gene | |
|---|---|
| Organism | Pyrococcus horikoshii |
| Genus | Pyrococcus |
| Species | horikoshi |
| Strain | |
| Sequence | MKFEAFKIVPVGYIRKEKNVFIEILPEFREGMEGLREGDWIKLILWFHKSDTPELRRILKVHPHGNPENPLTGVFATRSPFRPNPYTVKVHKIEGNRIYIDWIDAEDGTPVSDIKIFPERYDCPKENYQSTSRLKS |