| Read Date | 2006-01-13 09:03:00 |
|---|---|
| Read Number | X0000062831370200601130903 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0859 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Lithium bromide | 9.0 | 0.1 M | [Li+].[Br-] |
| PEG 400 | 9.0 | 40.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SR417 |
|---|---|
| Spine Status | aggregation screening |
| Length | 118 aa |
| Mass | 12.90 kD |
| ext | 8480 |
| pI | 4.53 |
| Name | YomS protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2X3N (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MTETTENVVITIPDKTSFTFHEAATSPSEGEEFVVGHFRELTVKISGSSTSREIKFYAVDENGEKTALSGTNKTDFQLGSSTLNTNEYWDFDIAGLFKVMFEVVSVTGDVTVKGIVVS |