| Read Date | 2006-01-13 09:06:00 |
|---|---|
| Read Number | X0000062831188200601130906 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1041 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 0.6 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SR417 |
|---|---|
| Spine Status | aggregation screening |
| Length | 118 aa |
| Mass | 12.90 kD |
| ext | 8480 |
| pI | 4.53 |
| Name | YomS protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2X3N (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MTETTENVVITIPDKTSFTFHEAATSPSEGEEFVVGHFRELTVKISGSSTSREIKFYAVDENGEKTALSGTNKTDFQLGSSTLNTNEYWDFDIAGLFKVMFEVVSVTGDVTVKGIVVS |