| Read Date | 2009-11-23 09:22:00 |
|---|---|
| Read Number | X0000116101360200911230922 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C1048 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| Cystamine dihydrochloride | 7.0 | 0.2 % (w/v) | Cl.Cl.S(SCCN)CCN |
| Spermine | 7.0 | 0.2 % (w/v) | C(CCNCCCN)CNCCCN |
| 1,4-Diaminobutane | 7.0 | 0.2 % (w/v) | C(CCN)CN |
| 1,8-Diaminooctane | 7.0 | 0.2 % (w/v) | C(CCCCN)CCCN |
| Cadaverine | 7.0 | 0.2 % (w/v) | NCCCCCN |
| Spermidine | 7.0 | 0.2 % (w/v) | C(CCNCCCN)CN |
| Tacsimate | 7.0 | 55.0 % (v/v) | missing |
![]() | HR4604D |
|---|---|
| Spine Status | X-Ray structure |
| Length | 81 aa |
| Mass | 9.62 kD |
| ext | 11000 |
| pI | 6.69 |
| Name | RecName: Full=Tripartite motif-containing protein 37;AltName: Full=Mulibrey nanism protein; |
| Database References | NCBI UniProt |
| PFAM | PF00643 |
| PDB Structures | 3LRQ (Xray) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQL |