| Read Date | 2009-12-18 11:08:00 |
|---|---|
| Read Number | X0000116821172200912181108 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C1037 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| 1,3,5-Pentanetricarboxylic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCC(C(=O)O)CCC(=O)O |
| Poly(3-hydroxybutyric acid) | 6.8 | 0.2 % (w/v) | O=C(O)CC(O)CC.O=C(O)CC(O)… |
| Benzoic acid | 6.8 | 0.2 % (w/v) | c1ccc(cc1)C(=O)O |
| 4-Hydroxyphenylacetic acid | 6.8 | 0.2 % (w/v) | O=C(O)Cc1ccc(O)cc1 |
![]() | HR4653B |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 78 aa |
| Mass | 9.05 kD |
| ext | 1490 |
| pI | 10.34 |
| Name | RecName: Full=Transcription factor NF-E2 45 kDa subunit;AltName: Full=Nuclear factor, erythroid-derived 2 45 kDa subunit;AltName: Full=p45 NF-E2;AltName: Full=Leucine zipper protein NF-E2; |
| Database References | NCBI UniProt |
| PFAM | PF00170 |
| PDB Structures | 2KZ5 (NMR) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | RGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLER |