| Read Date | 2006-03-13 14:09:00 |
|---|---|
| Read Number | X0000064760688200603131409 |
| Week | 6 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1096 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium Malonate | 6.0 | 2.4 M | [Na+].[Na+].[O-]C(=O)CC([… |
![]() | SR485 |
|---|---|
| Spine Status | HSQC collected |
| Length | 86 aa |
| Mass | 9.61 kD |
| ext | 5960 |
| pI | 5.37 |
| Name | Hypothetical protein ywqI |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MSEIKLKYDTVIKTLDSVKDALADVSIGAAGSNGKNSLDYTKKYHEREENIKTMLGDYKKAVQKNIEDTKDNVDSLKEQDEAIAVK |