| Read Date | 2005-06-16 15:52:00 |
|---|---|
| Read Number | X0000050751316200506161552 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C1517 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Magnesium sulfate heptahydrate | 7.0 | 1.8 M | [Mg+2].[O-]S([O-])(=O)=O.… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | XcR35 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 124 aa |
| Mass | 13.39 kD |
| ext | 9970 |
| pI | 5.42 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF04430 |
| PDB Structures | 2GM2 (NMR) |
| Gene | |
|---|---|
| Organism | Xanthomonas campestris |
| Genus | Xanthomonas |
| Species | campestris |
| Strain | |
| Sequence | MPLNQEHPDYTYALRAADGRHAKVNEQILQQSFILMPDELVEHWPVPSLGQLQPAHMDAVLALNPAVILLGTGERQQFPSTDVLAACLTRGIGLEAMTNAAAARTYNVLASEGRRVALAMIVGG |