| Read Date | 2006-03-24 10:36:00 |
|---|---|
| Read Number | X0000067001257200603241036 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 6_C0171 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Sodium molybdate dihydrate | 4.0 | 0.7 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
![]() | ER231 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 86 aa |
| Mass | 9.41 kD |
| ext | 0 |
| pI | 5.24 |
| Name | DNA-damage-inducible protein J |
| Database References | NCBI UniProt |
| PFAM | PF04221 |
| PDB Structures | 4Q2U (Best Match) |
| Gene | |
|---|---|
| Organism | Escherichia coli |
| Genus | Escherichia |
| Species | coli |
| Strain | |
| Sequence | MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI |