| Read Date | 2006-04-13 10:53:00 |
|---|---|
| Read Number | X0000067931492200604131053 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1525 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | GR52 |
|---|---|
| Spine Status | HSQC collected |
| Length | 101 aa |
| Mass | 11.27 kD |
| ext | 8480 |
| pI | 4.90 |
| Name | V-type ATP synthase subunit F (EC 3.6.3.14) (V-type ATPase subunit F) |
| Database References | NCBI UniProt |
| PFAM | PF01990 |
| PDB Structures | 2I4R (Best Match) |
| Gene | |
|---|---|
| Organism | Archaeoglobus fulgidus |
| Genus | Archaeoglobus |
| Species | fulgidus |
| Strain | |
| Sequence | MKKLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIIKQEYLKKLPPVLRREIDEKVEPTFVSVGGTGGVEEIREKIRKAIGVDLWK |