xtuition

X0000069401372200606091731

X0000069401372200606091731

Well
Read Date2006-06-09 17:31:00
Read NumberX0000069401372200606091731
Week6
Verified Crystal
3-Way Classifier
10-Way Classifier
Cocktail6_C1051
ScreenHWI Generation 6
Cocktail: 6_C1051
Name pH Concentration SMILES
Sodium phosphate monobasic monohydrate 5.0 1.8 M [Na+].[O-]P(=O)(O)O.O
Potassium phosphate dibasic anhydrous 5.0 0.0 M [K+].[K+].[O-]P([O-])(=O)…
Sample: X000006940
NESGSfR74
Spine StatusHSQC collected
Length73 aa
Mass8.45 kD
ext9970
pI10.27
Name
Hypothetical protein yeeT
Database References NCBI UniProt
PFAM PF06174
PDB Structures 2O5N (Best Match)
Sequence
Gene
OrganismShigella flexneri
GenusShigella
Speciesflexneri
Strain
Sequence
MKIITRGEAMRIHRQHPASRLFPFCTGKYRWHGSTDTYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN