| Read Date | 2006-06-09 17:31:00 |
|---|---|
| Read Number | X0000069401389200606091731 |
| Week | 6 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0096 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Potassium acetate | 4.0 | 5.8 M | CC(=O)[O-].[K+] |
![]() | SfR74 |
|---|---|
| Spine Status | HSQC collected |
| Length | 73 aa |
| Mass | 8.45 kD |
| ext | 9970 |
| pI | 10.27 |
| Name | Hypothetical protein yeeT |
| Database References | NCBI UniProt |
| PFAM | PF06174 |
| PDB Structures | 2O5N (Best Match) |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MKIITRGEAMRIHRQHPASRLFPFCTGKYRWHGSTDTYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN |