| Read Date | 2006-05-26 10:22:00 |
|---|---|
| Read Number | X0000070201500200605261022 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C1527 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Potassium sodium tartrate tetrahydrate | 8.5 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | AtR92 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 187 aa |
| Mass | 20.29 kD |
| ext | 23490 |
| pI | 5.38 |
| Name | AGR_C_4470p |
| Database References | UniProt |
| PFAM | PF06228 |
| PDB Structures | 2HQV (Xray) |
| Gene | |
|---|---|
| Organism | Agrobacterium tumefaciens |
| Genus | Agrobacterium |
| Species | tumefaciens |
| Strain | |
| Sequence | MANAIRLPPEAYPMSIAAQKNDDDRQARALAALAEKPDGIVEAIAAKAEVAPAEILAILPQGAAVSAPADRFDAIWNEMRGWGEILMIVQTGDIVLEVPGHLPEGTESHGWFNIHGDSPIGGHIKKDNCAAITFVDRGFHGRRSCSVWFMNAAGGAMFKIFVRRDENKELLAGQLAKFEELRDGFRG |