| Read Date | 2005-07-08 10:12:00 |
|---|---|
| Read Number | X0000053011274200507081012 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 5_C0943 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Potassium acetate | 6.0 | 0.1 M | CC(=O)[O-].[K+] |
| PEG 400 | 6.0 | 80.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | ZR18 |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 83 aa |
| Mass | 9.41 kD |
| ext | 6990 |
| pI | 4.65 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF08712 |
| PDB Structures | 1PQX (NMR) 2FFM (Xray) 2M6Q (NMR) 2M8W (NMR) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE |