| Read Date | 2005-07-08 10:13:00 |
|---|---|
| Read Number | X0000053011174200507081013 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C0846 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Ammonium phosphate monobasic | 5.0 | 0.1 M | [O-]P(=O)(O)O.[NH4+] |
| PEG 400 | 5.0 | 40.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | ZR18 |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 83 aa |
| Mass | 9.41 kD |
| ext | 6990 |
| pI | 4.65 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF08712 |
| PDB Structures | 1PQX (NMR) 2FFM (Xray) 2M6Q (NMR) 2M8W (NMR) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE |