| Read Date | 2006-06-09 08:20:00 |
|---|---|
| Read Number | X0000070371045200606090820 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C0454 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Lithium sulfate monohydrate | 4.0 | 0.1 M | [Li+].[Li+].[O-]S([O-])(=… |
| PEG 8000 | 4.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | ScR24 |
|---|---|
| Spine Status | HSQC collected |
| Length | 60 aa |
| Mass | 6.86 kD |
| ext | 6990 |
| pI | 4.68 |
| Name | Putative inner membrane protein |
| Database References | NCBI UniProt |
| PFAM | PF03966 |
| PDB Structures | 2JS4 (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella enterica |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MDHRLLEIIACPVCNGKLWYNQEQQELICKLDNLAFPLRDGIPVLLENEARALTSDESKS |