| Read Date | 2006-06-09 09:52:00 |
|---|---|
| Read Number | X0000070431392200606090952 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C1056 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 8.2 | 1.7 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | EfR50 |
|---|---|
| Spine Status | HSQC collected |
| Length | 112 aa |
| Mass | 12.14 kD |
| ext | 8480 |
| pI | 5.01 |
| Name | PhnA protein |
| Database References | UniProt |
| PFAM | PF03831 |
| PDB Structures | 2AKL (Best Match) |
| Gene | |
|---|---|
| Organism | Enterococcus faecalis |
| Genus | Enterococcus |
| Species | faecalis |
| Strain | |
| Sequence | MTEQLPNCPECGSAYAYEDRGLFICPECGHEWSPTEEVAEEGLVVKDSNGNLLADGDSVTVIKDLKVKGASGAIKQGTKVKNIRLVEGDHNIDCKVDGFGPMKLKSEFVKKN |