| Read Date | 2006-06-16 09:04:00 |
|---|---|
| Read Number | X0000070821421200606160904 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C0476 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Ammonium nitrate | 7.0 | 0.1 M | [O-][N+]([O-])=O.[NH4+] |
| PEG 8000 | 7.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SR476 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 101 aa |
| Mass | 11.47 kD |
| ext | 1490 |
| pI | 7.06 |
| Name | YvgZ protein |
| Database References | NCBI UniProt |
| PFAM | PF02583 |
| PDB Structures | 4M1P (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MEKHNEHKTLNHKSSKEKDQITNRLKRIEGQVRGIQNMVENDRYCVDILVQISAVQAAMKNVALHLLEDHAHHCVADAIKSGDGEQAISELLDVFKKFTKS |