| Read Date | 2006-06-16 09:33:00 |
|---|---|
| Read Number | X0000070831192200606160933 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C1042 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.9 | 0.3 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.9 | 0.6 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | ZR215 |
|---|---|
| Spine Status | NMR structure |
| Length | 67 aa |
| Mass | 7.90 kD |
| ext | 5960 |
| pI | 5.40 |
| Name | Hypothetical protein MW0776 |
| Database References | NCBI UniProt |
| PFAM | PF06855 |
| PDB Structures | 2KVS (NMR) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMAN |