| Read Date | 2006-06-16 10:31:00 |
|---|---|
| Read Number | X0000070871016200606161031 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C1406 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| PEG MME 2000 | 8.5 | 20.0 % (w/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
| Trimethylamine N-oxide dihydrate | 8.5 | 0.2 M | [O-][N+](C)(C)C.O.O |
![]() | EfR61 |
|---|---|
| Spine Status | HSQC collected |
| Length | 186 aa |
| Mass | 20.55 kD |
| ext | 4470 |
| pI | 4.73 |
| Name | EF0080 (PTS system, IIB component) |
| Database References | UniProt |
| PFAM | PF03780 |
| PDB Structures | 3JB3 (Best Match) |
| Gene | |
|---|---|
| Organism | Enterococcus faecalis |
| Genus | Enterococcus |
| Species | faecalis |
| Strain | |
| Sequence | MSNEKFNNVPKPAGNGPHTPEDHAIKGELTFEDKVVQKIIGLALENVDGLLTVDGGFFSNIAEKLVNTDNVTAGIDTEVGKKQVAVDMDIVVEYGKDIQDIYEKMKELISREVKKMTHLDVIEVNVNVVDIKSKEEYEEDSETVQDKVTGAAKSTGEFASEQTEKAKKAVNKGTEQVKENMEPRVE |