| Read Date | 2005-07-11 11:13:00 |
|---|---|
| Read Number | X0000053051535200507111113 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 5_C0768 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium bromide | 8.0 | 0.1 M | [Br-].[NH4+] |
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| PEG 1000 | 8.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | BeR44 |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 128 aa |
| Mass | 14.21 kD |
| ext | 27960 |
| pI | 4.59 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF03476 |
| PDB Structures | 2EXN (Best Match) |
| Gene | |
|---|---|
| Organism | Bordetella pertussis |
| Genus | Bordetella |
| Species | pertussis |
| Strain | |
| Sequence | MSTTAYQPIAECGATTQSEAAAYQKRWLVANDAGQWLNRDLCPRLAEVSVELRMGYLVLKAPGMLRLDIPLDVIEDDDSVRYQMLVGEQTVDVVDEGELAAAWISNHAGVPCRILKVHPDMAEVRWPS |