| Read Date | 2006-07-21 21:15:00 |
|---|---|
| Read Number | X0000071361157200607212115 |
| Week | 6 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0074 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Magnesium chloride hexahydrate | 5.0 | 3.7 M | [Mg+2].[Cl-].[Cl-].O.O.O.… |
![]() | ScR59 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 141 aa |
| Mass | 15.18 kD |
| ext | 11460 |
| pI | 5.83 |
| Name | Unc-112-related protein 2 (Kindlin-3) (MIG2-like) |
| Database References | UniProt |
| PFAM | PF03479 |
| PDB Structures | 2HX0 (Xray) |
| Gene | |
|---|---|
| Organism | Salmonella enterica |
| Genus | Salmonella |
| Species | enterica |
| Strain | |
| Sequence | MTVSHHNASTARFYALRLLPGQEVFSQLHAFVQQNQLHAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGAMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSR |