| Read Date | 2005-06-01 08:26:00 |
|---|---|
| Read Number | X0000050061164200506010826 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C1035 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 0.5 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | AtR55 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 146 aa |
| Mass | 15.93 kD |
| ext | 29450 |
| pI | 5.21 |
| Name | Hypothetical protein Atu3615 (AGR_L_2421p) |
| Database References | UniProt |
| PFAM | PF06172 |
| PDB Structures | 1ZNP (Xray) |
| Gene | |
|---|---|
| Organism | Agrobacterium tumefaciens |
| Genus | Agrobacterium |
| Species | tumefaciens |
| Strain | |
| Sequence | MGTDMSAQAIIRELGLEPHPEGGFYHQTFRDKAGGERGHSTAIYYLLEKGVRSHWHRVTDAVEVWHYYAGAPIALHLSQDGREVQTFTLGPAILEGERPQVIVPANCWQSAESLGDFTLVGCTVSPGFAFSSFVMAEPGWSPGDAP |