| Read Date | 2005-07-11 12:17:00 |
|---|---|
| Read Number | X0000053101152200507111217 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 5_C1512 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Lithium sulfate monohydrate | 8.5 | 1.5 M | [Li+].[Li+].[O-]S([O-])(=… |
![]() | MaR72 |
|---|---|
| Spine Status | HSQC collected |
| Length | 140 aa |
| Mass | 15.65 kD |
| ext | 13980 |
| pI | 5.04 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF01894 |
| PDB Structures | 2P6C (Best Match) |
| Gene | |
|---|---|
| Organism | Methanosarcina mazei |
| Genus | Methanosarcina |
| Species | mazei |
| Strain | |
| Sequence | MPVETREISVTAKEDCGIVDITGIVSEEVEKSEIKNGTVTVFCVGSTGAISTMEFESNLSKDISEILDKLIPLNEDYHHHKTWGDFNGGSHLRSFLLGPSLTVPFVEKKLTLGTWQQIVYINFDRIEKVRKIVLQIIGDL |