| Read Date | 2005-06-17 08:06:00 |
|---|---|
| Read Number | X0000051261302200506170806 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 5_C1322 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium sulfate | 6.5 | 0.2 M | O=S(=O)(O)O.N.N |
| MES monohydrate | 6.5 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| PEG MME 5000 | 6.5 | 30.0 % (w/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
![]() | JR65 |
|---|---|
| Spine Status | HSQC collected |
| Length | 103 aa |
| Mass | 11.69 kD |
| ext | 2980 |
| pI | 5.21 |
| Name | V-type ATP synthase subunit F (EC 3.6.3.14) (V-type ATPase subunit F) |
| Database References | NCBI UniProt |
| PFAM | PF01990 |
| PDB Structures | 2QAI (Best Match) |
| Gene | |
|---|---|
| Organism | Pyrococcus horikoshii |
| Genus | Pyrococcus |
| Species | horikoshi |
| Strain | |
| Sequence | MKVVIMGDSDTVVGFRLAGIHEAYEFDLSELSIERARNKLKELVERDDVGIILITERLAQKIGELPQVNLPIILQIPDKFGSIYGEELLREIVRRAVGIEVKR |