| Read Date | 2006-09-08 07:44:00 |
|---|---|
| Read Number | X0000075341365200609080744 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 6_C0090 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 2.5 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | CaR42 |
|---|---|
| Spine Status | HSQC collected |
| Length | 64 aa |
| Mass | 7.18 kD |
| ext | 4470 |
| pI | 5.43 |
| Name | Small acid-soluble spore protein |
| Database References | NCBI UniProt |
| PFAM | PF00269 |
| PDB Structures | 2Z3X (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium acetobutylicum |
| Genus | Clostridium |
| Species | acetobutylicum |
| Strain | |
| Sequence | MANYNKKLVPEKAERLNRFRMETANDIGVDLKAEYGSDLTSKEAGSVGGKMIDKILQGYEDKIE |