| Read Date | 2006-09-08 08:02:00 |
|---|---|
| Read Number | X0000075351368200609080802 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C1050 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 8.2 | 1.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | CaR48 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 104 aa |
| Mass | 11.90 kD |
| ext | 8940 |
| pI | 5.59 |
| Name | Uncharacterized conserved protein |
| Database References | UniProt |
| PFAM | PF06125 |
| PDB Structures | 2K5D (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium acetobutylicum |
| Genus | Clostridium |
| Species | acetobutylicum |
| Strain | |
| Sequence | MELKYVIPNMEKTFGNLEYAGEGNIEQRRVNGHNTILSRSYNLYSDIQRADDIVVILPAEAGEKHFEVEKRVKLINPRITAEGYKIGTRGFTNYILHADDMVEA |