| Read Date | 2006-09-08 08:04:00 |
|---|---|
| Read Number | X0000075351224200609080804 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C1422 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium acetate | 5.5 | 0.2 M | O=C(O)C.N |
| Bis-Tris | 5.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
| PEG 3350 | 5.5 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | CaR48 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 104 aa |
| Mass | 11.90 kD |
| ext | 8940 |
| pI | 5.59 |
| Name | Uncharacterized conserved protein |
| Database References | UniProt |
| PFAM | PF06125 |
| PDB Structures | 2K5D (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium acetobutylicum |
| Genus | Clostridium |
| Species | acetobutylicum |
| Strain | |
| Sequence | MELKYVIPNMEKTFGNLEYAGEGNIEQRRVNGHNTILSRSYNLYSDIQRADDIVVILPAEAGEKHFEVEKRVKLINPRITAEGYKIGTRGFTNYILHADDMVEA |