| Read Date | 2006-09-08 08:19:00 |
|---|---|
| Read Number | X0000075371534200609080819 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 6_C1344 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| PEG 20000 | 9.0 | 10.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bicine | 9.0 | 0.1 M | O=C(O)CN(CCO)CCO |
| 1,4-Dioxane | 9.0 | 2.0 % (v/v) | O1CCOCC1 |
![]() | CpR35 |
|---|---|
| Spine Status | HSQC collected |
| Length | 90 aa |
| Mass | 10.12 kD |
| ext | 6990 |
| pI | 9.82 |
| Name | Small acid-soluble spore protein beta |
| Database References | UniProt |
| PFAM | PF00269 |
| PDB Structures | 4O28 (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium perfringens |
| Genus | Clostridium |
| Species | perfringens |
| Strain | |
| Sequence | MSKTPLKKIIKGKIKSNKELTPAEKLREKMKYEIAGELGLSDKVDKFGWGGLTAEETGRIGGLMTKRKKELKLPSNDEILGRKKPHVDEK |