| Read Date | 2006-09-08 08:21:00 |
|---|---|
| Read Number | X0000075371360200609080821 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 6_C1048 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.9 | 0.5 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.9 | 0.9 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | CpR35 |
|---|---|
| Spine Status | HSQC collected |
| Length | 90 aa |
| Mass | 10.12 kD |
| ext | 6990 |
| pI | 9.82 |
| Name | Small acid-soluble spore protein beta |
| Database References | UniProt |
| PFAM | PF00269 |
| PDB Structures | 4O28 (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium perfringens |
| Genus | Clostridium |
| Species | perfringens |
| Strain | |
| Sequence | MSKTPLKKIIKGKIKSNKELTPAEKLREKMKYEIAGELGLSDKVDKFGWGGLTAEETGRIGGLMTKRKKELKLPSNDEILGRKKPHVDEK |