| Read Date | 2006-09-15 08:49:00 |
|---|---|
| Read Number | X0000075821500200609150849 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1527 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Potassium sodium tartrate tetrahydrate | 8.5 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | CpR36 |
|---|---|
| Spine Status | crystal hits |
| Length | 90 aa |
| Mass | 9.56 kD |
| ext | 5500 |
| pI | 4.92 |
| Name | Ethanolamine utilization protein |
| Database References | UniProt |
| PFAM | PF03319 |
| PDB Structures | 4N8X (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium perfringens |
| Genus | Clostridium |
| Species | perfringens |
| Strain | |
| Sequence | MEIGRVVGNVWATRKDEKLNGQKFLIVKLLVSKDKEKEGLFVAADNAGAGIGDIVLITKGGAARQSIGNREVPIDAAIVGIVDSIDIEED |