| Read Date | 2006-09-28 09:11:00 |
|---|---|
| Read Number | X0000076241389200609280911 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C0096 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Potassium acetate | 4.0 | 5.8 M | CC(=O)[O-].[K+] |
![]() | ER386 |
|---|---|
| Spine Status | crystal hits |
| Length | 126 aa |
| Mass | 13.59 kD |
| ext | 5960 |
| pI | 5.34 |
| Name | Doc protein |
| Database References | NCBI UniProt |
| PFAM | PF02661 |
| PDB Structures | 3K33 (Best Match) |
| Gene | |
|---|---|
| Organism | Escherichia coli |
| Genus | Escherichia |
| Species | coli |
| Strain | |
| Sequence | MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE |