| Read Date | 2006-09-29 07:43:00 |
|---|---|
| Read Number | X0000076311364200609290743 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 6_C1049 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 7.5 | 0.2 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 7.5 | 1.2 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | LmR49 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 89 aa |
| Mass | 9.27 kD |
| ext | 6990 |
| pI | 4.58 |
| Name | Lmo1184 protein |
| Database References | UniProt |
| PFAM | PF03319 |
| PDB Structures | 4N8X (Best Match) |
| Gene | |
|---|---|
| Organism | Listeria monocytogenes |
| Genus | Listeria |
| Species | monocytogenes |
| Strain | |
| Sequence | MQIGKVTGSLWATRKDEKLNGLKLLLVEICTDETEDVRHSIVAADNAGAGNGDLVLVTTGSAARASTGDNTIPVDACIVGIIDSVERYG |