| Read Date | 2006-09-29 07:45:00 |
|---|---|
| Read Number | X0000076311293200609290745 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 6_C0180 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Sodium nitrate | 7.0 | 1.3 M | [Na+].[O-][N+]([O-])=O |
![]() | LmR49 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 89 aa |
| Mass | 9.27 kD |
| ext | 6990 |
| pI | 4.58 |
| Name | Lmo1184 protein |
| Database References | UniProt |
| PFAM | PF03319 |
| PDB Structures | 4N8X (Best Match) |
| Gene | |
|---|---|
| Organism | Listeria monocytogenes |
| Genus | Listeria |
| Species | monocytogenes |
| Strain | |
| Sequence | MQIGKVTGSLWATRKDEKLNGLKLLLVEICTDETEDVRHSIVAADNAGAGNGDLVLVTTGSAARASTGDNTIPVDACIVGIIDSVERYG |