| Read Date | 2006-10-20 07:33:00 |
|---|---|
| Read Number | X0000077281385200610200733 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 7_C0095 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Potassium acetate | 9.0 | 8.6 M | CC(=O)[O-].[K+] |
![]() | AtR76 |
|---|---|
| Spine Status | HSQC collected |
| Length | 98 aa |
| Mass | 10.36 kD |
| ext | 0 |
| pI | 6.36 |
| Name | Conjugal transfer protein traC |
| Database References | NCBI UniProt |
| PFAM | PF07820 |
| PDB Structures | 1BDB (Best Match) |
| Gene | |
|---|---|
| Organism | Agrobacterium tumefaciens |
| Genus | Agrobacterium |
| Species | tumefaciens |
| Strain | |
| Sequence | MKKPSSKIREEIARLQDQLKQAETREAERIGRIALKAGLGEIDIEESQLQAAFEEVAKRFRGGKGSATGKRQAGESRTGTEPSAALASGADEGGSGEA |