| Read Date | 2006-10-20 14:35:00 |
|---|---|
| Read Number | X0000077401310200610201435 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1324 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 6.5 | 1.6 M | [Na+].[Na+].[Na+].O=C([O-… |
![]() | SR326 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 104 aa |
| Mass | 12.02 kD |
| ext | 8480 |
| pI | 4.97 |
| Name | YflH protein |
| Database References | NCBI UniProt |
| PFAM | PF11588 |
| PDB Structures | 3D0W (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MNRDQEKIQIENEMNAMHGTIKEDILKDFEEFKGYLKKQVNRGKKLGLDDGKLVKSAAILGDYLAKHEEPQNGEEMLLQELWSVADEDEKEHLAQLLVKLVDKQ |