| Read Date | 2006-10-20 14:09:00 |
|---|---|
| Read Number | X0000077411528200610201409 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1534 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Ammonium acetate | 8.5 | 4.0 M | O=C(O)C.N |
![]() | SR326 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 104 aa |
| Mass | 12.02 kD |
| ext | 8480 |
| pI | 4.97 |
| Name | YflH protein |
| Database References | NCBI UniProt |
| PFAM | PF11588 |
| PDB Structures | 3D0W (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MNRDQEKIQIENEMNAMHGTIKEDILKDFEEFKGYLKKQVNRGKKLGLDDGKLVKSAAILGDYLAKHEEPQNGEEMLLQELWSVADEDEKEHLAQLLVKLVDKQ |