| Read Date | 2006-10-27 09:33:00 |
|---|---|
| Read Number | X0000077991511200610270933 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0762 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| Ammonium thiocyanate | 7.5 | 0.1 M | [S-]C#N.[NH4+] |
| PEG 1000 | 7.5 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | PaR82 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 96 aa |
| Mass | 10.81 kD |
| ext | 17990 |
| pI | 7.66 |
| Name | Hypothetical protein |
| Database References | UniProt |
| PFAM | PF10262 |
| PDB Structures | 2OKA (Xray) |
| Gene | |
|---|---|
| Organism | Pseudomonas aeruginosa |
| Genus | Pseudomonas |
| Species | aeruginosa |
| Strain | |
| Sequence | MPTAKPEIVITYCTQCQWLLRAAWLAQELLSTFADDLGKVCLEPGTGGVFRITCDGVQVWERKADGGFPEAKALKQRVRDRIDPQRDLGHNDRPSR |