| Read Date | 2006-10-27 09:36:00 |
|---|---|
| Read Number | X0000077991304200610270936 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1514 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Magnesium sulfate heptahydrate | 7.0 | 1.0 M | [Mg+2].[O-]S([O-])(=O)=O.… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | PaR82 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 96 aa |
| Mass | 10.81 kD |
| ext | 17990 |
| pI | 7.66 |
| Name | Hypothetical protein |
| Database References | UniProt |
| PFAM | PF10262 |
| PDB Structures | 2OKA (Xray) |
| Gene | |
|---|---|
| Organism | Pseudomonas aeruginosa |
| Genus | Pseudomonas |
| Species | aeruginosa |
| Strain | |
| Sequence | MPTAKPEIVITYCTQCQWLLRAAWLAQELLSTFADDLGKVCLEPGTGGVFRITCDGVQVWERKADGGFPEAKALKQRVRDRIDPQRDLGHNDRPSR |