| Read Date | 2006-10-27 10:35:00 |
|---|---|
| Read Number | X0000078031133200610271035 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0548 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium bromide | 8.0 | 0.1 M | [Br-].[NH4+] |
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| PEG 4000 | 8.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | KR76 |
|---|---|
| Spine Status | aggregation screening |
| Length | 171 aa |
| Mass | 19.71 kD |
| ext | 20400 |
| pI | 4.78 |
| Name | Probable 16S rRNA-processing protein rimM |
| Database References | NCBI UniProt |
| PFAM | PF01782 |
| PDB Structures | 2F1L (Best Match) |
| Gene | |
|---|---|
| Organism | Lactococcus lactis |
| Genus | Lactococcus |
| Species | lactis |
| Strain | |
| Sequence | MEKFYKVGTIVNTQGLQGEVRVMPSTDFAQERFSKGSVLALFDDKDNYIQDLKVKSGRPQKNFYVVKFEGFYHINDVEKYKGYIVKIAEENQEDLDDGEFYYHEIIGSDVYENDILIGQISEILQPGANDVWVVKRKGKRDLLLPYIPPVILNVDVNQHRVDVSIMEGLDD |