| Read Date | 2006-11-17 08:16:00 |
|---|---|
| Read Number | X0000079281359200611170816 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0280 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Potassium nitrate | 4.0 | 0.1 M | [K+].[O-][N+]([O-])=O |
| PEG 20000 | 4.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | CdR44 |
|---|---|
| Spine Status | aggregation screening |
| Length | 232 aa |
| Mass | 25.61 kD |
| ext | 35410 |
| pI | 5.53 |
| Name | Putative alkylated DNA repair protein |
| Database References | NCBI UniProt |
| PFAM | PF13532 |
| PDB Structures | 3I49 (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium diphtheriae |
| Genus | Corynebacterium |
| Species | diphtheriae |
| Strain | |
| Sequence | MLFDSLPRPSERIAPGVAHLPGWLGVDKQAELVREIREIARTYADTPMAMLRPTLKSGGQMSVYQLHLGRYWHYPSYRYIDKIAGTTVPPVPDSLAALAPEALRAAAEVAEELAPWVETFVPEMVLVNYYPPGSRMGMHVDEFEESRAPVISVSIGDEALFRMGHTESRTQPWDDVTLCSGDLVVFGGPKRFAYHGVVRVNDATLPDGCGLEQGRINITIRQVSAAPNVQGR |