| Read Date | 2006-11-17 08:56:00 |
|---|---|
| Read Number | X0000079310664200611170856 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1390 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| PEG MME 5000 | 6.5 | 20.0 % (w/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
| Bis-Tris | 6.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
![]() | BbR6 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 74 aa |
| Mass | 8.35 kD |
| ext | 5960 |
| pI | 5.78 |
| Name | MutS2 protein |
| Database References | NCBI UniProt |
| PFAM | PF06289 |
| PDB Structures | 4WSG (Best Match) |
| Gene | |
|---|---|
| Organism | Borrelia burgdorferi |
| Genus | Borrelia |
| Species | burgdorferi |
| Strain | |
| Sequence | MIFVTKLNGDGYYLNPYHIESIEANPDTTILLMNGKKLIVKEKVEEVVNRIKLYRKEVASLEKILGEGNGGVEL |