| Read Date | 2005-06-02 13:13:00 |
|---|---|
| Read Number | X0000050111196200506021313 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 5_C1043 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 7.5 | 0.2 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 7.5 | 0.9 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | GsR40 |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 163 aa |
| Mass | 18.81 kD |
| ext | 34950 |
| pI | 6.52 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF01878 |
| PDB Structures | 2AR1 (Best Match) |
| Gene | |
|---|---|
| Organism | Geobacter sulfurreducens |
| Genus | Geobacter |
| Species | sulfurreducens |
| Strain | |
| Sequence | MNRERRYWLFKSEPSCFSFDDLGSRPNGTEHWDGVRNFQARNLLRDEIKPGDGVLFYHSNVPDPAVVGIARVVREGYPDWTALDPAGEHFDPRAGRNNPIWYMVDVRYVKPLARPVTLAELKMHPEVADMVLLQRSRLSVQPVTPAQWEFILRLGGIHEPFNL |