| Read Date | 2006-12-15 07:52:00 |
|---|---|
| Read Number | X0000080671265200612150752 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 7_C0173 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Sodium molybdate dihydrate | 10.0 | 0.7 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
![]() | BbR7 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 92 aa |
| Mass | 10.18 kD |
| ext | 0 |
| pI | 11.05 |
| Name | 50S ribosomal protein L28 |
| Database References | NCBI UniProt |
| PFAM | PF00830 |
| PDB Structures | 4WFN (Best Match) |
| Gene | |
|---|---|
| Organism | Borrelia burgdorferi |
| Genus | Borrelia |
| Species | burgdorferi |
| Strain | |
| Sequence | MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSVSIKVSANALRSISKIGLDAFLKKNCKKIENFL |