| Read Date | 2006-12-22 10:49:00 |
|---|---|
| Read Number | X0000080690932200612221049 |
| Week | 2 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 7_C1493 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.0 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | HR3159 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 160 aa |
| Mass | 17.82 kD |
| ext | 15470 |
| pI | 4.33 |
| Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118; |
| Database References | NCBI UniProt |
| PFAM | PF01248 |
| PDB Structures | 2KG4 (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |