| Read Date | 2005-07-29 09:39:00 |
|---|---|
| Read Number | X0000054451465200507290939 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C0187 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium phosphate monobasic | 8.0 | 1.1 M | [Na+].[O-]P(=O)(O)O |
![]() | QR6 |
|---|---|
| Spine Status | NMR structure |
| Length | 116 aa |
| Mass | 12.66 kD |
| ext | 5960 |
| pI | 4.33 |
| Name | Protein aq_1857 |
| Database References | NCBI UniProt |
| PFAM | PF01521 |
| PDB Structures | 1NWB (NMR) |
| Gene | |
|---|---|
| Organism | Aquifex aeolicus |
| Genus | Aquifex |
| Species | aeolicus |
| Strain | |
| Sequence | MQEQAQQFIFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEGDHVFEYDGVKVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNPNATGSCGCGSSFSCG |