| Read Date | 2006-12-15 09:22:00 |
|---|---|
| Read Number | X0000080741332200612150922 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1521 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| di-Ammonium Tartrate | 8.5 | 0.7 M | O=C([O-])C(O)C(O)C([O-])=… |
![]() | EwR41 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 166 aa |
| Mass | 18.25 kD |
| ext | 13980 |
| pI | 5.61 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF06228 |
| PDB Structures | 2PH0 (Xray) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | MTMTLNELLATNPDGTLEDIAGKYNTSLFAVVEALPTAQCTLATGDRFDQVWDTIATWGEVTLISHTADAILEFKSELPTGTHRHGYFNLRGKNGLSGHIRATSCQHIAFIERKFMGMDTASVVFFNANGAAMFKIFLGRDSHRQLLSAQVDAFRALASELQPEQV |