| Read Date | 2007-01-12 21:41:00 |
|---|---|
| Read Number | X0000080791148200701122141 |
| Week | 5 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1511 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Lithium sulfate monohydrate | 7.0 | 1.5 M | [Li+].[Li+].[O-]S([O-])(=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | EwR17 |
|---|---|
| Spine Status | good HSQC collected |
| Length | 60 aa |
| Mass | 6.76 kD |
| ext | 2980 |
| pI | 5.21 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF03966 |
| PDB Structures | 2JS4 (Best Match) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | MDHRLLEIVACPVCNGRLYFNKEKLELICKADGLAYPVRDGIPVLLENEARKLGADEITQ |