| Read Date | 2005-07-29 10:39:00 |
|---|---|
| Read Number | X0000054471189200507291039 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C0082 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Magnesium sulfate heptahydrate | 8.0 | 1.6 M | [Mg+2].[O-]S([O-])(=O)=O.… |
![]() | ZR31 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 94 aa |
| Mass | 10.58 kD |
| ext | 5960 |
| pI | 5.07 |
| Name | Hypothetical protein MW2441 |
| Database References | UniProt |
| PFAM | PF00583 |
| PDB Structures | 1R57 (NMR) 2H5M (NMR) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | MSNLEIKQGENKFYIGDDENHALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLVKAVVEHARENHLKIIASCSFAKHMLEKEDSYQDVYLG |