| Read Date | 2007-01-11 11:58:00 |
|---|---|
| Read Number | X0000081391226200701111158 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 7_C1231 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 4.0 | 2.0 M | [Na+].[Cl-] |
| Citric acid | 4.0 | 0.1 M | C(C(=O)O)C(CC(=O)O)(C(=O)… |
![]() | XcR91 |
|---|---|
| Spine Status | crystal hits |
| Length | 140 aa |
| Mass | 16.03 kD |
| ext | 14440 |
| pI | 4.97 |
| Name | Hypothetical protein XCC1670 |
| Database References | NCBI UniProt |
| PFAM | PF05523 |
| PDB Structures | 2PA7 (Best Match) |
| Gene | |
|---|---|
| Organism | Xanthomonas campestris |
| Genus | Xanthomonas |
| Species | campestris |
| Strain | |
| Sequence | MAIERIQLHTHGDDRGLLISLEQQRNVPFEIRRVYYIFGTRQGVHRGQHAHRQLNQLAVALHGSVTLLLDEGQGQGPEEVVLDDPSQGVLLGRMVWRDLHQFSEDCVLMVLADQYYDPGDYILDYDEFLTEARGVSRLEA |