| Read Date | 2007-01-15 10:14:00 |
|---|---|
| Read Number | X0000081571384200701151014 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1054 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.9 | 0.6 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.9 | 1.2 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | VcR80 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 130 aa |
| Mass | 14.44 kD |
| ext | 9970 |
| pI | 6.61 |
| Name | Hypothetical protein VCA0587 |
| Database References | UniProt |
| PFAM | PF03479 |
| PDB Structures | 2P6Y (Xray) |
| Gene | |
|---|---|
| Organism | Vibrio cholerae |
| Genus | Vibrio |
| Species | cholerae |
| Strain | |
| Sequence | MIHLIALRLTRGMDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQHCHLHIAVADAQGRVWGGHLLEGNLINTTAELMIHHYPQHHFTREFDPNTGYSELVVS |